Structure of PDB 1yro Chain C

Receptor sequence
>1yroC (length=123) Species: 10090 (Mus musculus) [Search protein sequence]
TELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAVVNDNGSTEY
GLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKG
IDYWKAYKPMCSEKLEQWRCEKP
3D structure
PDB1yro Mutation of Arginine 228 to Lysine Enhances the Glucosyltransferase Activity of Bovine beta-1,4-Galactosyltransferase I
ChainC
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) T33 N45 S47 E49 S56
Catalytic site (residue number reindexed from 1) T33 N45 S47 E49 S56
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA C K79 D82 E84 D87 D88 K79 D82 E84 D87 D88
Gene Ontology
Molecular Function
GO:0004461 lactose synthase activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0005989 lactose biosynthetic process
Cellular Component
GO:0005576 extracellular region
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1yro, PDBe:1yro, PDBj:1yro
PDBsum1yro
PubMed15736931
UniProtP29752|LALBA_MOUSE Alpha-lactalbumin (Gene Name=Lalba)

[Back to BioLiP]