Structure of PDB 1yo5 Chain C

Receptor sequence
>1yo5C (length=88) Species: 9606 (Homo sapiens) [Search protein sequence]
QPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKN
RPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHP
3D structure
PDB1yo5 Analysis of the 2.0 A Crystal Structure of the Protein-DNA Complex of the Human PDEF Ets Domain Bound to the Prostate Specific Antigen Regulatory Site
ChainC
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C S284 Y302 R307 R310 Y313 K320 R326 L327 Y329 S38 Y56 R61 R64 Y67 K74 R80 L81 Y83
BS02 dna C H250 L251 W291 K295 M300 K304 R307 S308 Y312 H4 L5 W45 K49 M54 K58 R61 S62 Y66
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1yo5, PDBe:1yo5, PDBj:1yo5
PDBsum1yo5
PubMed15882048
UniProtO95238|SPDEF_HUMAN SAM pointed domain-containing Ets transcription factor (Gene Name=SPDEF)

[Back to BioLiP]