Structure of PDB 1ye6 Chain C

Receptor sequence

>1ye6C (length=319)

SIPDIKLSSGHLMPSIGFGCWKLANATAGEQVYQAIKAGYRLFDGAEDYG
NEKEVGDGVKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADL
KVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKA
LEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKL
IEFAQKAGVTITAYSSFGPQSFVEMNQGRALNTPTLFAHDTIKAIAAKYN
KTPAEVLLRWAAQRGIAVIPRSNLPERLVQNRSFNTFDLTKEDFEEIAKL
DIGLRFNDPWDWDNIPIFV

3D structure

• PDB: 1ye6 Fine tuning of coenzyme specificity in family 2 aldo-keto reductases revealed by crystal structures of the Lys-274-->Arg mutant of Candida tenuis xylose reductase (AKR2B5) bound to NAD(+) and NADP(+).
• Chain: C
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D47 Y52 K81 H114
• Catalytic site (residue number reindexed from 1): D44 Y49 K78 H111
• Enzyme Commision number: 1.1.1.307: D-xylose reductase [NAD(P)H].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	C	G22 C23 W24 D47 Y52 Q191 Y217 F220 Q223 S224 A257 I272 P273 R274 S275 N276 R280 Q283 N284 N310	G19 C20 W21 D44 Y49 Q188 Y214 F217 Q220 S221 A254 I269 P270 R271 S272 N273 R277 Q280 N281 N307

Gene Ontology

Molecular Function

• GO:0004032 aldose reductase (NADPH) activity
• GO:0016491 oxidoreductase activity
• GO:0032866 D-xylose reductase (NADPH) activity

Biological Process

• GO:0042732 D-xylose metabolic process
• GO:0042843 D-xylose catabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1ye6, PDBe:1ye6, PDBj:1ye6
• PDBsum: 1ye6
• PubMed: 15670843
• UniProt: O74237|XYL1_CANTE NAD(P)H-dependent D-xylose reductase (Gene Name=XYL1)