Structure of PDB 1xm5 Chain C

Receptor sequence
>1xm5C (length=148) Species: 562 (Escherichia coli) [Search protein sequence]
QVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRVVDTAESH
SLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLVICRQVVEKEAQEQGK
PLEAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPY
3D structure
PDB1xm5 The ybeY protein from Escherichia coli is a metalloprotein.
ChainC
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NI C H3114 H3118 H3124 H112 H116 H122
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016151 nickel cation binding
GO:0016892 RNA endonuclease activity, producing 3'-phosphomonoesters
GO:0046872 metal ion binding
Biological Process
GO:0006364 rRNA processing
GO:0006412 translation
GO:0009408 response to heat
GO:0030490 maturation of SSU-rRNA
GO:0031564 transcription antitermination
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1xm5, PDBe:1xm5, PDBj:1xm5
PDBsum1xm5
PubMed16511207
UniProtP0A898|YBEY_ECOLI Endoribonuclease YbeY (Gene Name=ybeY)

[Back to BioLiP]