Structure of PDB 1xhv Chain C

Receptor sequence

>1xhvC (length=247) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKRPKSGGEPFEKLVYKFLKENLSDLTFKQYE
YLNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWIENLFEEKQ
NDTADILLVKQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKMIDNKE
FDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQF
HVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI

3D structure

• PDB: 1xhv Mechanistic Insights from the Structures of HincII Bound to Cognate DNA Cleaved from Addition of Mg(2+) and Mn(2+)
• Chain: C
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	Q138 Y199 N201 A204 R241 K248	Q128 Y189 N191 A194 R231 K238
BS02	dna	C	H73 E74 Y77 R91 G92 K93 K108 Q109	H65 E66 Y69 R83 G84 K85 K99 Q100
BS03	dna	C	Q109 N110 I143 S144 K147 A205 M206 Q207	Q100 N101 I133 S134 K137 A195 M196 Q197
BS04	dna	C	E38 D114 K129 T130 R131 N132 A137 Q138 A139 P140 N141	E30 D105 K119 T120 R121 N122 A127 Q128 A129 P130 N131
BS05	MN	C	H73 E74	H65 E66
BS06	MN	C	D114 D127	D105 D117
BS07	MN	C	E38 D114 V128	E30 D105 V118

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:1xhv, PDBe:1xhv, PDBj:1xhv
• PDBsum: 1xhv
• PubMed: 15476804
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)