Structure of PDB 1xg0 Chain C

Receptor sequence

>1xg0C (length=174) Species: 79257 (Rhodomonas sp. CS24)

DAFSRVVTADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVS
DAVSGMICENPSLISPSGNCYTNRRMAACLRDGEIILRYVSYALLSGDAS
VLEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLST
PQGDCSGLASEVGGYFDKVTAAIS

3D structure

• PDB: 1xg0 Developing a structure-function model for the cryptophyte phycoerythrin 545 using ultrahigh resolution crystallography and ultrafast laser spectroscopy
• Chain: C
• Resolution: 0.97 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	C	C50 D54 S57 G58 C61 R129 A136 C137 A140 F141 S147 Q148	C47 D51 S54 G55 C58 R126 A133 C134 A137 F138 S144 Q145
BS02	PEB	C	L24 K28 N35 K36 L38 D39 V142 N143 T153 P154 Q155 G156 C158	L21 K25 N32 K33 L35 D36 V139 N140 T150 P151 Q152 G153 C155
BS03	PEB	C	M59 N72 C73 R77 R78 A81 C82 R84 D85 I88 L120 V122 N127	M56 N69 C70 R74 R75 A78 C79 R81 D82 I85 L117 V119 N124
BS04	PEB	C	C50 Q148	C47 Q145

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:1xg0, PDBe:1xg0, PDBj:1xg0
• PDBsum: 1xg0
• PubMed: 15504407
• UniProt: P27198|PHEB_RHDS2 B-phycoerythrin beta chain (Gene Name=cpeB)