Structure of PDB 1xf6 Chain C

Receptor sequence

>1xf6C (length=173) Species: 79257 (Rhodomonas sp. CS24) [Search protein sequence]

DAFSRVVADSKAAYVGGADLQALKKFISEGNKRLDSVNSIVSNASCIVSD
AVSGMICENPSLISPSGNCYTNRRMAACLRDGEIILRYVSYALLSGDASV
LEDRCLNGLKETYSSLGVPANSNARAVSIMKACAVAFVNNTASQKKLSTP
QGDCSGLASEVGGYFDKVTAAIS

3D structure

PDB

1xf6 Developing a structure-function model for the cryptophyte phycoerythrin 545 using ultrahigh resolution crystallography and ultrafast laser spectroscopy

Chain

Resolution

1.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	C	C50 D54 S57 G58 C61 R129 A136 C137 A140 F141 S147 Q148	C46 D50 S53 G54 C57 R125 A132 C133 A136 F137 S143 Q144
BS02	PEB	C	L24 K28 N35 K36 L38 D39 V142 N143 T153 P154 Q155 G156 C158	L20 K24 N31 K32 L34 D35 V138 N139 T149 P150 Q151 G152 C154
BS03	PEB	C	M59 N72 C73 R77 R78 A81 C82 R84 D85 I88 L120 V122 N127	M55 N68 C69 R73 R74 A77 C78 R80 D81 I84 L116 V118 N123

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1xf6, PDBe:1xf6, PDBj:1xf6
PDBsum	1xf6
PubMed	15504407
UniProt	P27198\|PHEB_RHDS2 B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]