Structure of PDB 1wrv Chain C

Receptor sequence

>1wrvC (length=295) Species: 274 (Thermus thermophilus)

QIKAGLIWMNGAFVPQEEAKTSVLSHALHYGTSVFEGIRAYETAKGPAIF
RLKEHVKRFYNSAKVLRMEIPFAPEELEEAIKEVVRRNGYRSCYIRPLAW
MGAKALGVNPLPNNPAEVMVAAWEWKGARLITSSWARFPANVMPGKAKVG
GNYVNSALAKMEAVAAGADEALLLDEEGYVAEGSGENLFFVRDGVIYALE
HSVNLEGITRDSVIRIAKDLGYEVQVVRATRDQLYMADEVFMTGTAAEVT
PVSMIDWRPIGKGTAGPVALRLREVYLEAVTGRRPEYEGWLTYVN

3D structure

• PDB: 1wrv Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase
• Chain: C
• Resolution: 1.5 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): F36 G38 K159 E193 L216
• Catalytic site (residue number reindexed from 1): F35 G37 K148 E182 L205
• Enzyme Commision number: 2.6.1.42: branched-chain-amino-acid transaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PLP	C	R59 K159 Y164 E193 G196 L216 G218 I219 T220 T256	R58 K148 Y153 E182 G185 L205 G207 I208 T209 T245

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004084 branched-chain-amino-acid transaminase activity
• GO:0008483 transaminase activity
• GO:0052654 L-leucine-2-oxoglutarate transaminase activity
• GO:0052655 L-valine-2-oxoglutarate transaminase activity
• GO:0052656 L-isoleucine-2-oxoglutarate transaminase activity

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009081 branched-chain amino acid metabolic process
• GO:0009082 branched-chain amino acid biosynthetic process
• GO:0009097 isoleucine biosynthetic process
• GO:0009098 L-leucine biosynthetic process
• GO:0009099 L-valine biosynthetic process
• GO:0019752 carboxylic acid metabolic process
• GO:0046394 carboxylic acid biosynthetic process

External links

• PDB: RCSB:1wrv, PDBe:1wrv, PDBj:1wrv
• PDBsum: 1wrv
• UniProt: Q5SM19