Structure of PDB 1vrc Chain C |
>1vrcC (length=85) Species: 562 (Escherichia coli) [Search protein sequence] |
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKL QTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE |
|
PDB | 1vrc Solution NMR structure of the 48-kDa IIAMannose-HPr complex of the Escherichia coli mannose phosphotransferase system. |
Chain | C |
Resolution | N/A |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PO3 |
C |
H215 T216 R217 |
H15 T16 R17 |
|
|
|
|