Structure of PDB 1v4u Chain C

Receptor sequence
>1v4uC (length=143) Species: 8237 (Thunnus thynnus) [Search protein sequence]
TTLSDKDKSTVKALWGKISKSADAIGADALGRMLAVYPQTKTYFSHWPDM
SPGSGPVKAHGKKVMGGVALAVSKIDDLTTGLGDLSELHAFKMRVDPSNF
KILSHCILVVVAKMFPKEFTPDAHVSLDKFLASVALALAERYR
3D structure
PDB1v4u Novel Mechanisms of pH Sensitivity in Tuna Hemoglobin: A STRUCTURAL EXPLANATION OF THE ROOT EFFECT
ChainC
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM C Y43 F44 H46 H60 K63 L85 H89 M93 V95 N99 L103 L138 Y43 F44 H46 H60 K63 L85 H89 M93 V95 N99 L103 L138
BS02 CMO C F44 H60 V64 F44 H60 V64
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1v4u, PDBe:1v4u, PDBj:1v4u
PDBsum1v4u
PubMed15117955
UniProtQ8AYM0

[Back to BioLiP]