Structure of PDB 1v15 Chain C

Receptor sequence
>1v15C (length=129) Species: 562 (Escherichia coli) [Search protein sequence]
SKRNKPGKATGKGKPVGDKWLDDAGKDSGAPIPDRIADKLRDKEFKSFDD
FRKAVWEEVSKDPELSKNLNPSNKSSVSKGYSPFTPKNQQVGGRKVYELH
ADKPISQGGEVYDMDNIRVTTPKRHIDIH
3D structure
PDB1v15 Structure-Based Analysis of the Metal-Dependent Mechanism of H-N-H Endonucleases
ChainC
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R5 R96 E100 H102 A103 H127 H131
Catalytic site (residue number reindexed from 1) R3 R94 E98 H100 A101 H125 H129
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R5 D51 R54 Y83 S84 E100 L101 H102 H127 R3 D49 R52 Y81 S82 E98 L99 H100 H125
BS02 dna C V93 G95 R96 I128 V91 G93 R94 I126
BS03 ZN C H102 H127 H131 H100 H125 H129
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0005102 signaling receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0019835 cytolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1v15, PDBe:1v15, PDBj:1v15
PDBsum1v15
PubMed15190054
UniProtP09883|CEA9_ECOLX Colicin-E9 (Gene Name=col)

[Back to BioLiP]