Structure of PDB 1ul3 Chain C |
>1ul3C (length=94) Species: 1143 (Synechocystis sp.) [Search protein sequence] |
MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFFLQKLKIEIVVDEG QVDMVVDKLVSAARTGEIGDGKIFISPVDSVVRIRTGEKDTEAI |
|
PDB | 1ul3 The structures of the PII proteins from the cyanobacteria Synechococcus sp. PCC 7942 and Synechocystis sp. PCC 6803. |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
C |
F11 D14 E15 |
F11 D14 E15 |
|
|
|
|