Structure of PDB 1tzy Chain C |
>1tzyC (length=95) Species: 9031 (Gallus gallus) [Search protein sequence] |
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVM ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
|
PDB | 1tzy High-resolution structure of the native histone octamer. |
Chain | C |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PO4 |
C |
R49 E50 R53 |
R9 E10 R13 |
|
|
|
|