Structure of PDB 1ttt Chain C

Receptor sequence

>1tttC (length=405) Species: 271 (Thermus aquaticus)

AKGEFIRTKPHVNVGTIGHVDHGKTTLTAALTYVAAAENPNVEVKDYGDI
DKAPEERARGITINTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMD
GAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLDLV
EMEVRDLLNQYEFPGDEVPVIRGSALLALEEMHKNPKTKRGENEWVDKIW
ELLDAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATGRIERGKVKVG
DEVEIVGLAPETRKTVVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVER
GQVLAKPGSITPHTKFEASVYILKKEEGGRHTGFFTGYRPQFYFRTTDVT
GVVRLPQGVEMVMPGDNVTFTVELIKPVALEEGLRFAIREGGRTVGAGVV
TKILE

3D structure

• PDB: 1ttt Crystal structure of the ternary complex of Phe-tRNAPhe, EF-Tu, and a GTP analog.
• Chain: C
• Resolution: 2.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K24 T25 T62 H85
• Catalytic site (residue number reindexed from 1): K24 T25 T62 H85

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	F335 T336 Q357 E360	F335 T336 Q357 E360
BS02	rna	C	K52 P54 E55 F229 I231 R234 G269 E271 R274 G287 R300 R330 H331 T332 G337 R339 Q341 T350 I375 K376 G391 G392	K52 P54 E55 F229 I231 R234 G269 E271 R274 G287 R300 R330 H331 T332 G337 R339 Q341 T350 I375 K376 G391 G392
BS03	PHE	C	H67 T239 M272 H273 N285 V286	H67 T239 M272 H273 N285 V286
BS04	MG	C	T25 D51 T62	T25 D51 T62
BS05	GNP	C	D21 H22 G23 K24 T25 T26 Y47 I61 T62 G84 N136 K137 D139 M140 S174 L176	D21 H22 G23 K24 T25 T26 Y47 I61 T62 G84 N136 K137 D139 M140 S174 L176

Gene Ontology

Molecular Function

• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1ttt, PDBe:1ttt, PDBj:1ttt
• PDBsum: 1ttt
• PubMed: 7491491
• UniProt: Q01698|EFTU_THEAQ Elongation factor Tu (Gene Name=tuf)