Structure of PDB 1tnz Chain C

Receptor sequence
>1tnzC (length=314) Species: 10116 (Rattus norvegicus) [Search protein sequence]
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFR
AVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNY
IIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQ
HRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRA
VLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQP
SHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKE
YWRYIGRSLQSKHS
3D structure
PDB1tnz Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
ChainC
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K164
Catalytic site (residue number reindexed from 1) K110
Enzyme Commision number 2.5.1.58: protein farnesyltransferase.
2.5.1.59: protein geranylgeranyltransferase type I.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide C Y166 Q167 Y112 Q113
BS02 MGM C Y166 Y200 H201 Y112 Y146 H147
Gene Ontology
Molecular Function
GO:0004659 prenyltransferase activity
GO:0004660 protein farnesyltransferase activity
GO:0004661 protein geranylgeranyltransferase activity
GO:0004662 CAAX-protein geranylgeranyltransferase activity
GO:0004663 Rab geranylgeranyltransferase activity
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008270 zinc ion binding
GO:0008318 protein prenyltransferase activity
GO:0030971 receptor tyrosine kinase binding
GO:0036094 small molecule binding
GO:0042277 peptide binding
GO:0043014 alpha-tubulin binding
GO:0060090 molecular adaptor activity
GO:1901363 heterocyclic compound binding
Biological Process
GO:0007167 enzyme-linked receptor protein signaling pathway
GO:0008284 positive regulation of cell population proliferation
GO:0014070 response to organic cyclic compound
GO:0018342 protein prenylation
GO:0018343 protein farnesylation
GO:0018344 protein geranylgeranylation
GO:0034097 response to cytokine
GO:0035022 positive regulation of Rac protein signal transduction
GO:0043066 negative regulation of apoptotic process
GO:0045787 positive regulation of cell cycle
GO:0051770 positive regulation of nitric-oxide synthase biosynthetic process
GO:0051771 negative regulation of nitric-oxide synthase biosynthetic process
GO:0090044 positive regulation of tubulin deacetylation
GO:1904395 positive regulation of skeletal muscle acetylcholine-gated channel clustering
Cellular Component
GO:0005737 cytoplasm
GO:0005875 microtubule associated complex
GO:0005953 CAAX-protein geranylgeranyltransferase complex
GO:0005965 protein farnesyltransferase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1tnz, PDBe:1tnz, PDBj:1tnz
PDBsum1tnz
PubMed15451670
UniProtQ04631|FNTA_RAT Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha (Gene Name=Fnta)

[Back to BioLiP]