Structure of PDB 1tfy Chain C

Receptor sequence

>1tfyC (length=437) Species: 2234 (Archaeoglobus fulgidus)

MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYAR
NTWLKGSLEIDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYV
HGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRL
LKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTV
IDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPS
LGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERA
SRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFE
DERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTL
GKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD

3D structure

• PDB: 1tfy Mechanism of transfer RNA maturation by CCA-adding enzyme without using an oligonucleotide template.
• Chain: C
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.72: CCA tRNA nucleotidyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	A95 A163 Y165 R224 A228 N229 D291 H396	A95 A163 Y165 R224 A228 N229 D291 H396
BS02	rna	C	Y165 N292 P295 Q296 R299 G401 K402	Y165 N292 P295 Q296 R299 G401 K402
BS03	MG	C	E59 D61	E59 D61
BS04	CTP	C	G46 S47 D61 T130 H133 Y161 R224	G46 S47 D61 T130 H133 Y161 R224

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0004810 CCA tRNA nucleotidyltransferase activity
• GO:0005524 ATP binding
• GO:0016779 nucleotidyltransferase activity
• GO:0046872 metal ion binding
• GO:0160016 CCACCA tRNA nucleotidyltransferase activity

Biological Process

• GO:0001680 tRNA 3'-terminal CCA addition
• GO:0008033 tRNA processing
• GO:0031123 RNA 3'-end processing
• GO:0042245 RNA repair
• GO:0106354 tRNA surveillance

External links

• PDB: RCSB:1tfy, PDBe:1tfy, PDBj:1tfy
• PDBsum: 1tfy
• PubMed: 15295590
• UniProt: O28126|CCA_ARCFU CCA-adding enzyme (Gene Name=cca)