Structure of PDB 1rwy Chain C

Receptor sequence
>1rwyC (length=109) Species: 10116 (Rattus norvegicus) [Search protein sequence]
SMTDLLSAEDIKKAIGAFTAADSFDHKKFFQMVGLKKKSADDVKKVFHIL
DKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLMAAGDKDGDGKIGVE
EFSTLVAES
3D structure
PDB1rwy Crystal Structure of Rat Alpha-Parvalbumin at 1.05 Resolution
ChainC
Resolution1.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA C D51 D53 S55 F57 E59 E62 D51 D53 S55 F57 E59 E62
BS02 CA C D90 D92 D94 K96 E101 D90 D92 D94 K96 E101
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
Biological Process
GO:0010467 gene expression
GO:0090102 cochlea development
GO:0098976 excitatory chemical synaptic transmission
GO:0098977 inhibitory chemical synaptic transmission
Cellular Component
GO:0005737 cytoplasm
GO:0030424 axon
GO:0032420 stereocilium
GO:0032437 cuticular plate
GO:0032991 protein-containing complex
GO:0043025 neuronal cell body
GO:0043195 terminal bouton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1rwy, PDBe:1rwy, PDBj:1rwy
PDBsum1rwy
PubMed15169955
UniProtP02625|PRVA_RAT Parvalbumin alpha (Gene Name=Pvalb)

[Back to BioLiP]