Structure of PDB 1rhm Chain C |
>1rhmC (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] |
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKY EVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGP VDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE |
|
PDB | 1rhm Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis. |
Chain | C |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NA4 |
C |
R679 H737 C785 |
R31 H88 C130 |
BindingDB: IC50=1735nM |
|
|
|