Structure of PDB 1r2c Chain C

Receptor sequence

>1r2cC (length=332) Species: 1079 (Blastochloris viridis)

CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGP
PVSQVYKNVKVLGNLTEAEFLRTMTAITEWVSPQEGCTYCHDENNLASEA
KYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEP
TLPLNNRETPTHVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQ
VRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSLGTNCTFCHNA
QTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEA
PQADCRTCHQGVTKPLFGASRLKDYPELGPIK

3D structure

• PDB: 1r2c Time-resolved crystallographic studies of light-induced structural changes in the photosynthetic reaction center.
• Chain: C
• Resolution: 2.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Y56 K57 N58 V59 K60 V61 F70 M74 T78 C87 C90 H91 L96 A97 Y104 A107 R108	Y56 K57 N58 V59 K60 V61 F70 M74 T78 C87 C90 H91 L96 A97 Y104 A107 R108
BS02	HEM	C	V81 Y89 Y102 V106 M110 L111 M113 T114 C132 C135 H136 L141 P142 L289 R293 P301	V81 Y89 Y102 V106 M110 L111 M113 T114 C132 C135 H136 L141 P142 L289 R293 P301
BS03	HEM	C	V201 R202 V204 M233 S237 C244 C247 H248 F253 E254 R264 A267 W268 R272	V201 R202 V204 M233 S237 C244 C247 H248 F253 E254 R264 A267 W268 R272
BS04	HEM	C	H124 V125 T128 Q263 I266 G270 I271 M273 V274 C305 C308 H309 K314 P315	H124 V125 T128 Q263 I266 G270 I271 M273 V274 C305 C308 H309 K314 P315

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:1r2c, PDBe:1r2c, PDBj:1r2c
• PDBsum: 1r2c
• PubMed: 15073325
• UniProt: P07173|CYCR_BLAVI Photosynthetic reaction center cytochrome c subunit (Gene Name=pufC)