Structure of PDB 1qvn Chain C

Receptor sequence
>1qvnC (length=122) Species: 9606 (Homo sapiens) [Search protein sequence]
SSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATEL
KHLQCLEEELKPLEEALNLAQRPRDLISNINVIVLELKGETTFMCEYADE
TATIVEFLNRWITFCQSIISTL
3D structure
PDB1qvn Hot-spot mimicry of a cytokine receptor by a small molecule.
ChainC
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FRI C N29 L36 T113 E116 N26 L33 T103 E106
BS02 FRI C K35 M39 T41 F42 K43 Y45 E62 P65 L72 K32 M36 T38 F39 K40 Y42 E59 P62 L69
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005134 interleukin-2 receptor binding
GO:0005515 protein binding
GO:0008083 growth factor activity
GO:0019209 kinase activator activity
GO:0030246 carbohydrate binding
GO:0031851 kappa-type opioid receptor binding
GO:0043208 glycosphingolipid binding
Biological Process
GO:0002250 adaptive immune response
GO:0002366 leukocyte activation involved in immune response
GO:0002639 positive regulation of immunoglobulin production
GO:0002903 negative regulation of B cell apoptotic process
GO:0006366 transcription by RNA polymerase II
GO:0006955 immune response
GO:0007155 cell adhesion
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007267 cell-cell signaling
GO:0008284 positive regulation of cell population proliferation
GO:0010467 gene expression
GO:0030101 natural killer cell activation
GO:0030217 T cell differentiation
GO:0030307 positive regulation of cell growth
GO:0030890 positive regulation of B cell proliferation
GO:0032729 positive regulation of type II interferon production
GO:0032740 positive regulation of interleukin-17 production
GO:0034105 positive regulation of tissue remodeling
GO:0038110 interleukin-2-mediated signaling pathway
GO:0042098 T cell proliferation
GO:0042102 positive regulation of T cell proliferation
GO:0042104 positive regulation of activated T cell proliferation
GO:0043066 negative regulation of apoptotic process
GO:0045471 response to ethanol
GO:0045582 positive regulation of T cell differentiation
GO:0045591 positive regulation of regulatory T cell differentiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046013 regulation of T cell homeostatic proliferation
GO:0046651 lymphocyte proliferation
GO:0048304 positive regulation of isotype switching to IgG isotypes
GO:0050672 negative regulation of lymphocyte proliferation
GO:0050728 negative regulation of inflammatory response
GO:0050729 positive regulation of inflammatory response
GO:0050798 activated T cell proliferation
GO:0060999 positive regulation of dendritic spine development
GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand
GO:0097696 cell surface receptor signaling pathway via STAT
GO:1900100 positive regulation of plasma cell differentiation
GO:1901327 response to tacrolimus
GO:2000320 negative regulation of T-helper 17 cell differentiation
GO:2000561 regulation of CD4-positive, alpha-beta T cell proliferation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1qvn, PDBe:1qvn, PDBj:1qvn
PDBsum1qvn
PubMed17032757
UniProtP60568|IL2_HUMAN Interleukin-2 (Gene Name=IL2)

[Back to BioLiP]