Structure of PDB 1qsm Chain C

Receptor sequence
>1qsmC (length=149) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
NITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMW
AAVAVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGK
LIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY
3D structure
PDB1qsm Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
ChainC
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ACO C F32 Y33 L93 V95 R100 V101 G103 G105 T128 R134 A135 L137 L138 Y139 K141 F25 Y26 L86 V88 R93 V94 G96 G98 T121 R127 A128 L130 L131 Y132 K134
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
GO:0008080 N-acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0042802 identical protein binding
GO:0061733 peptide-lysine-N-acetyltransferase activity
Biological Process
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0032917 polyamine acetylation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:1990331 Hpa2 acetyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1qsm, PDBe:1qsm, PDBj:1qsm
PDBsum1qsm
PubMed10600387
UniProtQ06592|HPA2_YEAST Histone acetyltransferase HPA2 (Gene Name=HPA2)

[Back to BioLiP]