Structure of PDB 1qs7 Chain C

Receptor sequence

>1qs7C (length=144) Species: 562 (Escherichia coli) [Search protein sequence]

TDEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINE
VDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDGNGFISAAE
LRHVMTNLGEKLTDEEVDEMIREADVDGDGQVNYEEFVQVMMAK

3D structure

PDB

1qs7 Target Enzyme Recognition by Calmodulin: 2.4 A Structure of a Calmodulin- Peptide Complex

Chain

Resolution

1.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

Enzymatic activity

Catalytic site (original residue number in PDB)	V35
Catalytic site (residue number reindexed from 1)	V31
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	C	E11 F12 E14 A15 F19 M36 M51 L71 M72 M76 E84 A88 F92 L105 M109 L112 E114 M124 A128 F141 V144 M145	E7 F8 E10 A11 F15 M32 M47 L67 M68 M72 E80 A84 F88 L101 M105 L108 E110 M120 A124 F137 V140 M141
BS02	CA	C	D20 D22 D24 T26 E31	D16 D18 D20 T22 E27
BS03	CA	C	D56 D58 N60 T62 D64 E67	D52 D54 N56 T58 D60 E63
BS04	CA	C	D93 D95 N97 F99 E104	D89 D91 N93 F95 E100
BS05	CA	C	D129 D131 D133 Q135 E140	D125 D127 D129 Q131 E136

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0046872	metal ion binding

External links