Structure of PDB 1qp9 Chain C

Receptor sequence
>1qp9C (length=71) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
NRIPLGCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKE
LLKDNELKKLRERVKSLEKTL
3D structure
PDB1qp9 Structure of HAP1-PC7 bound to DNA: implications for DNA recognition and allosteric effects of DNA-binding on transcriptional activation.
ChainC
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R59 K71 R2 K14 PDBbind-CN: Kd=37.8nM
BS02 dna C R68 K71 K73 R11 K14 K16 PDBbind-CN: Kd=37.8nM
BS03 ZN C C64 C67 C74 C81 C7 C10 C17 C24
BS04 ZN C C64 C81 C84 C93 C7 C24 C27 C36
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1qp9, PDBe:1qp9, PDBj:1qp9
PDBsum1qp9
PubMed11024163
UniProtP0CS82|HAP1_YEASX Heme-responsive zinc finger transcription factor HAP1 (Gene Name=HAP1)

[Back to BioLiP]