Structure of PDB 1qmp Chain C |
>1qmpC (length=126) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] |
SIKVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKRPDI LLLDIIMPHLDGLAVLERIRAGFEHQPNVIMLTAFGQEDVTKKAVELGAS YFILKPFDMENLAHHIRQVYGKTPVV |
|
PDB | 1qmp Phosphorylated aspartate in the structure of a response regulator protein. |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
C |
D10 X55 I57 |
D9 X54 I56 |
|
|
|
|