Structure of PDB 1ppj Chain C

Receptor sequence

>1ppjC (length=365) Species: 9913 (Bos taurus) [Search protein sequence]

NNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFS
SVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWN
IGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWI
WGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSD
VDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNT
PPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRS
MMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILV
LMPTAGTIENKLLKW

3D structure

PDB

1ppj Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.

Chain

Resolution

2.1 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H201 S205 K227 D228 E271
Catalytic site (residue number reindexed from 1)	H187 S191 K213 D214 E257
Enzyme Commision number	1.10.2.2: Transferred entry: 7.1.1.8.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	JZR	C	H345 T349 I350	H331 T335 I336
BS02	HEM	C	Q44 G48 L49 L51 R80 H83 T126 G130 Y131 L133 H182 F183 P186	Q30 G34 L35 L37 R66 H69 T112 G116 Y117 L119 H168 F169 P172
BS03	HEM	C	W31 G34 L37 H97 R100 S106 T112 W113 G116 V117 L119 H196 L197 L200 S205 N206	W17 G20 L23 H83 R86 S92 T98 W99 G102 V103 L105 H182 L183 L186 S191 N192
BS04	SMA	C	F128 M129 M138 G142 V145 I146 P270 E271 F274 Y278	F114 M115 M124 G128 V131 I132 P256 E257 F260 Y264
BS05	ANY	C	I27 W31 S35 L197 F220 Y224 D228	I13 W17 S21 L183 F206 Y210 D214

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0048039	ubiquinone binding

	Biological Process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0031966	mitochondrial membrane
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ppj, PDBe:1ppj, PDBj:1ppj
PDBsum	1ppj
PubMed	16024040
UniProt	P00157\|CYB_BOVIN Cytochrome b (Gene Name=MT-CYB)

[Back to BioLiP]