Structure of PDB 1pey Chain C |
>1peyC (length=120) Species: 1423 (Bacillus subtilis) [Search protein sequence] |
MNEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLV LLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTH FAKPFDIDEIRDAVKKYLPL |
|
PDB | 1pey Metals in the sporulation phosphorelay: manganese binding by the response regulator Spo0F. |
Chain | C |
Resolution | 2.25 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
C |
D11 D54 K56 |
D10 D53 K55 |
|
|
|
|