Structure of PDB 1p6v Chain C

Receptor sequence

>1p6vC (length=125) Species: 63363 (Aquifex aeolicus)

SDKIIPIAENKEAKAKYDILETYEAGIVLKGSEVKSLREKGTVSFKDSFV
RIENGEAWLYNLYIAPYKHANHDPLRKRKLLLHKREIMRLYGKVQEKGYT
IIPLKLYWKNNKVKVLIALAKGKKL

3D structure

• PDB: 1p6v Crystal structure of the transfer-RNA domain of transfer-messenger RNA in complex with SmpB
• Chain: C
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	M93 Y96 G97 K98 Q100 E101	M88 Y91 G92 K93 Q95 E96
BS02	rna	C	E26 A27 I29 L31 V36 E58 L86 L87 H88 K89 E91 K117 V118 K119	E24 A25 I27 L29 V34 E56 L81 L82 H83 K84 E86 K112 V113 K114

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0070929 trans-translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1p6v, PDBe:1p6v, PDBj:1p6v
• PDBsum: 1p6v
• PubMed: 12904796
• UniProt: O66640|SSRP_AQUAE SsrA-binding protein (Gene Name=smpB)