Structure of PDB 1p51 Chain C

Receptor sequence
>1p51C (length=92) Species: 1167 (Anabaena sp.) [Search protein sequence]
MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSF
ESRERKAREGRNPKTNEKMEIPATRVPAFSAGKLFREKVAPP
3D structure
PDB1p51 Flexible DNA bending in HU-DNA cocrystal structures
ChainC
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R53 R55 K56 R58 R61 P63 R53 R55 K56 R58 R61 P63 PDBbind-CN: Kd=3.5nM
BS02 dna C R58 R61 N62 P63 K64 M69 I71 R58 R61 N62 P63 K64 M69 I71 PDBbind-CN: Kd=3.5nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0030261 chromosome condensation
GO:0043158 heterocyst development
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1p51, PDBe:1p51, PDBj:1p51
PDBsum1p51
PubMed12853489
UniProtP05514|DBH_NOSS1 DNA-binding protein HU (Gene Name=hup)

[Back to BioLiP]