Structure of PDB 1ouu Chain C

Receptor sequence

>1ouuC (length=142) Species: 8022 (Oncorhynchus mykiss)

SLTAKDKSVVKAFWGKISGKADVVGAEALGRMLTAYPQTKTYFSHWADLS
PGSGPVKKHGGIIMGAIGKAVGLMDDLVGGMSALSDLHAFKLRVDPGNFK
ILSHNILVTLAIHFPSDFTPEVHIAVDKFLAAVSAALADKYR

3D structure

• PDB: 1ouu The crystal structures of trout Hb I in the deoxy and carbonmonoxy forms.
• Chain: C
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Y42 F43 H45 H59 I62 L84 H88 L92 V94 N98 F99 L102 L137	Y42 F43 H45 H59 I62 L84 H88 L92 V94 N98 F99 L102 L137

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:1ouu, PDBe:1ouu, PDBj:1ouu
• PDBsum: 1ouu
• PubMed: 8683580
• UniProt: P02019|HBA1_ONCMY Hemoglobin subunit alpha-1 (Gene Name=hba1)