Structure of PDB 1oct Chain C

Receptor sequence
>1octC (length=131) Species: 9606 (Homo sapiens) [Search protein sequence]
DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALN
LSFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEE
ITMIADQLNMEKEVIRVWFCNRRQKEKRINP
3D structure
PDB1oct Crystal structure of the Oct-1 POU domain bound to an octamer site: DNA recognition with tethered DNA-binding modules.
ChainC
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R20 T26 Q27 Q44 T45 S48 R49 R102 K103 R105 T106 R113 V147 N151 R16 T22 Q23 Q40 T41 S44 R45 R72 K73 R75 T76 R83 V117 N121
BS02 dna C S43 T46 R49 S56 N59 K62 R102 R105 K125 S128 R146 R153 S39 T42 R45 S52 N55 K58 R72 R75 K95 S98 R116 R123
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1oct, PDBe:1oct, PDBj:1oct
PDBsum1oct
PubMed8156594
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]