Structure of PDB 1ntm Chain C

Receptor sequence

>1ntmC (length=378) Species: 9913 (Bos taurus) [Search protein sequence]

TNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFL
AMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRG
LYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLS
AIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLH
ETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLG
DPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILIL
ALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIG
QLASVLYFLLILVLMPTAGTIENKLLKW

3D structure

PDB

1ntm Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site

Chain

Resolution

2.4 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H201 S205 K227 D228 E271
Catalytic site (residue number reindexed from 1)	H200 S204 K226 D227 E270
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Q44 I45 G48 L49 Y55 R80 H83 A84 A87 T126 G130 Y131 L133 H182 P186	Q43 I44 G47 L48 Y54 R79 H82 A83 A86 T125 G129 Y130 L132 H181 P185
BS02	HEM	C	W31 G34 L37 H97 R100 S106 W113 G116 V117 L119 H196 L200 S205 N206	W30 G33 L36 H96 R99 S105 W112 G115 V116 L118 H195 L199 S204 N205

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0048039	ubiquinone binding

	Biological Process
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0031966	mitochondrial membrane
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1ntm, PDBe:1ntm, PDBj:1ntm
PDBsum	1ntm
PubMed	12885240
UniProt	P00157\|CYB_BOVIN Cytochrome b (Gene Name=MT-CYB)

[Back to BioLiP]