Structure of PDB 1njj Chain C

Receptor sequence

>1njjC (length=352) Species: 31285 (Trypanosoma brucei gambiense)

RFLEGFNTRDALCKKGDPFFVADLGDIVRKHETWKKCLPRVTPFYAVKCN
DDWRVLGTLAALGTGFDCASNTEIQRVRGIGVPPEKIIYANPCKQISHIR
YARDSGVDVMTFDCVDELEKVAKTHPKAKMVLRISTVKFGAKVEDCRFIL
EQAKKLNIDVTGVSFHVGSGSTDASTFAQAISDSRFVFDMGTELGFNMHI
LDIGGGFPGTRDAPLKFEEIAGVINNALEKHFPPDLKLTIVAEPGRYYVA
SAFTLAVNVIAKKVTQSFMYYVNDGVYGSFNCILYDHAVVRPLPQREPIE
KLYPSSVWGPTCDGLDQIVERYYLPEMQVGEWLLFEDMGAYTVVSPTIYY
VV

3D structure

• PDB: 1njj X-ray Structure Determination of Trypanosoma brucei Ornithine Decarboxylase Bound to D-Ornithine and to G418: INSIGHTS INTO SUBSTRATE BINDING AND ODC CONFORMATIONAL FLEXIBILITY.
• Chain: C
• Resolution: 2.45 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K69 H197 E274
• Catalytic site (residue number reindexed from 1): K48 H166 E243
• Enzyme Commision number: 4.1.1.17: ornithine decarboxylase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GET	C	R22 D243 L339 Q341 L382 E384	R9 D212 L293 Q295 L334 E336	MOAD: Ki=8mM
BS02	ORX	C	K69 H197 G236 G237 E274 R277 D332 Y389	K48 H166 G205 G206 E243 R246 D286 Y341	MOAD: Kd=0.27mM

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004586 ornithine decarboxylase activity
• GO:0016829 lyase activity

Biological Process

• GO:0006596 polyamine biosynthetic process
• GO:0033387 putrescine biosynthetic process from ornithine

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1njj, PDBe:1njj, PDBj:1njj
• PDBsum: 1njj
• PubMed: 12672797
• UniProt: Q9TZZ6