Structure of PDB 1n1i Chain C |
>1n1iC (length=93) Species: 5851 (Plasmodium knowlesi strain H) [Search protein sequence] |
SAHKCIDTNVPENAACYRYLDGTEEWRCLLGFKEVGGKCVPASITCEENN GGCAPEAECTMDDKKEVECKCTKEGSEPLFEGVFCSSSSGPHH |
|
PDB | 1n1i Structure of the C-terminal domains of merozoite surface protein-1 from Plasmodium knowlesi reveals a novel histidine binding site |
Chain | C |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HIS |
C |
W34 E42 |
W26 E34 |
|
|
|