Structure of PDB 1m6z Chain C

Receptor sequence

>1m6zC (length=190) Species: 316 (Stutzerimonas stutzeri)

AGDAEAGQGKVAVCGACHGVDGNSPAPNFPKLAGQGERYLLKQLQDIKAG
STPGAPEGVGRKVLEMTGMLDPLSDQDLEDIAAYFSSQKGSVGYADPALA
KQGEKLFRGGKLDQGMPACTGCHAPNGVGNDLAGFPKLGGQHAAYTAKQL
TDFREGNRTNDGDTMIMRGVAAKLSNKDIEALSSYIQGLH

3D structure

• PDB: 1m6z Cytochrome c4
• Chain: C
• Resolution: 1.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	C	V13 C14 C17 H18 F29 P30 L32 Y39 L44 I47 R61 V63 E65 M66 M69 Y145 K148 Q149	V13 C14 C17 H18 F29 P30 L32 Y39 L44 I47 R61 V63 E65 M66 M69 Y145 K148 Q149
BS02	HEC	C	Y39 K42 Q43 C119 C122 H123 F135 P136 L138 Y145 R158 N160 I166 M167 V170	Y39 K42 Q43 C119 C122 H123 F135 P136 L138 Y145 R158 N160 I166 M167 V170

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:1m6z, PDBe:1m6z, PDBj:1m6z
• PDBsum: 1m6z
• UniProt: Q52369|CYC4_STUST Cytochrome c4 (Gene Name=cc4)