Structure of PDB 1m6x Chain C

Receptor sequence

>1m6xC (length=400) Species: 4932 (Saccharomyces cerevisiae)

SQFDILCKTPPKVLVRQFVERFERPSGEKIASCAAELTYLCWMITHNGTA
IKRATFMSYNTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWE
FTIIPYNSDITDIVSSLQLQFESNSHSKKMLKALLSEGESIWEITEKILN
SFEYTSRFTKTKTLYQFLFLATFINCGRFSDIKNVDPKSFKLVQNKYLGV
IIQCLVTETKTSVSRHIYFFSARGRIDPLVYLDEFLRNSEPVLKRVNRTG
NKQEYQLLKDNLVRSYNKALKKNAPYPIFAIKNGPKSHIGRHLMTSFLSM
KGLTELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPI
SKEMIALKDETNPIEEWQHIEQEGSIRYPAWNGIISQEVLDYLSSYINRR

3D structure

• PDB: 1m6x Structural Plasticity of the Flp-Holliday Junction Complex
• Chain: C
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	H47 K53 A55 T56 Y60 K82 F192 S193 R281 N284 K299 N300 K303 S304 H305	H46 K52 A54 T55 Y59 K81 F179 S180 R264 N267 K282 N283 K286 S287 H288
BS02	dna	C	T342 Y343	T325 Y326
BS03	dna	C	V338 Y343	V321 Y326
BS04	dna	C	S2 Q3 T62 R170 T174 Y178 R191 K223 T224 N278 R281 S282 K285 K289 R308 S331	S1 Q2 T61 R157 T161 Y165 R178 K210 T211 N261 R264 S265 K268 K272 R291 S314

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003690 double-stranded DNA binding
• GO:0003697 single-stranded DNA binding
• GO:0008301 DNA binding, bending
• GO:0009009 site-specific recombinase activity

Biological Process

• GO:0006310 DNA recombination
• GO:0015074 DNA integration
• GO:0042150 plasmid recombination

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:1m6x, PDBe:1m6x, PDBj:1m6x
• PDBsum: 1m6x
• PubMed: 12559911
• UniProt: P03870|FLP_YEAST Site-specific recombinase Flp (Gene Name=FLP1)