Structure of PDB 1m5o Chain C

Receptor sequence
>1m5oC (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
3D structure
PDB1m5o Transition state stabilization by a catalytic RNA
ChainC
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C Y13 N15 N16 E19 S46 S48 L49 K50 M51 R52 Q54 F56 Q85 A87 K88 D90 S91 D92 Y8 N10 N11 E14 S41 S43 L44 K45 M46 R47 Q49 F51 Q80 A82 K83 D85 S86 D87
BS02 CA C S46 R47 S41 R42
BS03 CA C K22 K23 R47 K17 K18 R42
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1m5o, PDBe:1m5o, PDBj:1m5o
PDBsum1m5o
PubMed12376595
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]