Structure of PDB 1llu Chain C

Receptor sequence

>1lluC (length=341) Species: 287 (Pseudomonas aeruginosa)

TLPQTMKAAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAA
EGDWPVKPPLPFIPGHEGVGYVAAVGSGVTRVKEGDRVGIPWLYTACGCC
EHCLTGWETLCESQQNTGYSVNGGYAEYVLADPNYVGILPKNVEFAEIAP
ILCAGVTVYKGLKQTNARPGQWVAISGIGGLGHVAVQYARAMGLHVAAID
IDDAKLELARKLGASLTVNARQEDPVEAIQRDIGGAHGVLVTAVSNSAFG
QAIGMARRGGTIALVGLPPGDFPTPIFDVVLKGLHIAGSIVGTRADLQEA
LDFAGEGLVKATIHPGKLDDINQILDQMRAGQIEGRIVLEM

3D structure

• PDB: 1llu The ternary complex of Pseudomonas aeruginosa alcohol dehydrogenase with NADH and ethylene glycol.
• Chain: C
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C44 H45 T46 H49 H67 E68 C98 C101 C104 C112 Q116 C154 T158 R337
• Catalytic site (residue number reindexed from 1): C43 H44 T45 H48 H66 E67 C97 C100 C103 C111 Q115 C153 T157 R336
• Enzyme Commision number: 1.1.1.1: alcohol dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	C	C44 H67 C154	C43 H66 C153
BS02	ZN	C	C101 C104 C112	C100 C103 C111
BS03	NAD	C	C44 H45 T46 H49 C154 T158 G180 G181 L182 D201 I202 K206 A244 V245 S246 A249 V266 L268 I291 V292 R337	C43 H44 T45 H48 C153 T157 G179 G180 L181 D200 I201 K205 A243 V244 S245 A248 V265 L267 I290 V291 R336
BS04	EDO	C	T46 W93 C154	T45 W92 C153
BS05	EDO	C	H45 L48 D54	H44 L47 D53

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0046872 metal ion binding

External links

• PDB: RCSB:1llu, PDBe:1llu, PDBj:1llu
• PDBsum: 1llu
• PubMed: 15152088
• UniProt: Q9HTD9