Structure of PDB 1kpg Chain C

Receptor sequence

>1kpgC (length=285) Species: 1773 (Mycobacterium tuberculosis)

DELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAK
IDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANH
VQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFS
LAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPG
GRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIA
LQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK

3D structure

• PDB: 1kpg Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis
• Chain: C
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.79: cyclopropane-fatty-acyl-phospholipid synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO3	C	S34 C35 G137 H167 I169 Y232	S32 C33 G135 H165 I167 Y230
BS02	SAH	C	V12 Y16 T32 S34 G72 G74 T94 L95 Q99 G122 W123 E124 I136 A138 H141 F142	V10 Y14 T30 S32 G70 G72 T92 L93 Q97 G120 W121 E122 I134 A136 H139 F140
BS03	16A	C	Y16 Y33 G137 E140 I169 L192 I195 F200 G203 Y232 C269	Y14 Y31 G135 E138 I167 L190 I193 F198 G201 Y230 C267

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity
• GO:0008825 cyclopropane-fatty-acyl-phospholipid synthase activity

Biological Process

• GO:0006629 lipid metabolic process
• GO:0008610 lipid biosynthetic process
• GO:0032259 methylation
• GO:0046500 S-adenosylmethionine metabolic process
• GO:0071768 mycolic acid biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane

External links

• PDB: RCSB:1kpg, PDBe:1kpg, PDBj:1kpg
• PDBsum: 1kpg
• PubMed: 11756461
• UniProt: P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 (Gene Name=cmaA1)