Structure of PDB 1k9m Chain C

Receptor sequence

>1k9mC (length=237) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPA
RSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVDAEIAPGNTLPLAEIP
EGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDP
QCRATIGVVGGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHP
FGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGG

3D structure

PDB

1k9m The structures of four macrolide antibiotics bound to the large ribosomal subunit.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	G1 R2 R3 G6 Q7 R8 R9 G10 R11 G12 T13 S14 T15 R17 A18 S20 H21 Y23 K24 A25 D26 K31 H47 R51 S52 S110 S111 G113 K117 F118 A119 R120 A121 S122 G123 L140 P141 S142 E144 K146 G162 G163 R164 T165 K167 P168 F169 V170 K171 A172 G173 K175 H176 H177 K178 K180 R182 G183 T184 K185 W186 P187 N188 V189 R190 G191 V192 M194 N195 V197 D198 G203 G204 G205 R206 Q207 H208 P209 G210 K211 P212 K213 S214 I215 S216 R217 N218 P220 P221 G222 R223 K224 V225 G226 D227 I228 A229 S230 K231 R232 T233 G234 R235 G236	G1 R2 R3 G6 Q7 R8 R9 G10 R11 G12 T13 S14 T15 R17 A18 S20 H21 Y23 K24 A25 D26 K31 H47 R51 S52 S110 S111 G113 K117 F118 A119 R120 A121 S122 G123 L140 P141 S142 E144 K146 G162 G163 R164 T165 K167 P168 F169 V170 K171 A172 G173 K175 H176 H177 K178 K180 R182 G183 T184 K185 W186 P187 N188 V189 R190 G191 V192 M194 N195 V197 D198 G203 G204 G205 R206 Q207 H208 P209 G210 K211 P212 K213 S214 I215 S216 R217 N218 P220 P221 G222 R223 K224 V225 G226 D227 I228 A229 S230 K231 R232 T233 G234 R235 G236
BS02	MG	C	N188 R190	N188 R190

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1k9m, PDBe:1k9m, PDBj:1k9m
PDBsum	1k9m
PubMed	12150912
UniProt	P20276\|RL2_HALMA Large ribosomal subunit protein uL2 (Gene Name=rpl2)

[Back to BioLiP]