Structure of PDB 1jzk Chain C

Receptor sequence
>1jzkC (length=145) [Search protein sequence]
SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYF
KRLGNVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNH
ITRKISAAEFGKFNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL
3D structure
PDB1jzk Restricting the Ligand-Linked Heme Movement in Scapharca Dimeric Hemoglobin Reveals Tight Coupling between Distal and Proximal Contributions to Cooperativity.
ChainC
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM C Y50 F51 R53 H69 L73 L77 F97 N100 H101 R104 I106 F111 F114 Y49 F50 R52 H68 L72 L76 F96 N99 H100 R103 I105 F110 F113
BS02 HEM C K96 N100 K95 N99
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001666 response to hypoxia
GO:0015671 oxygen transport
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jzk, PDBe:1jzk, PDBj:1jzk
PDBsum1jzk
PubMed11732898
UniProtP02213|GLB1_ANAIN Globin-1

[Back to BioLiP]