Structure of PDB 1jm0 Chain C

Receptor sequence
>1jm0C (length=48) [Search protein sequence]
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
3D structure
PDB1jm0 Toward the de novo design of a catalytically active helix bundle: a substrate-accessible carboxylate-bridged dinuclear metal center.
ChainC
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN C E10 E36 H39 E10 E36 H39
BS02 MN C Q16 E19 Q16 E19
BS03 DMS C L9 E10 A13 E36 L9 E10 A13 E36
External links