Structure of PDB 1jkq Chain C

Receptor sequence
>1jkqC (length=46) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence]
RPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
3D structure
PDB1jkq Testing water-mediated DNA recognition by the Hin recombinase.
ChainC
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R140 R142 A143 G172 S174 T175 R178 Y179 R1 R3 A4 G33 S35 T36 R39 Y40 PDBbind-CN: Kd=27.1nM
BS02 dna C R140 Y177 P181 A182 S183 R1 Y38 P42 A43 S44 PDBbind-CN: Kd=27.1nM
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1jkq, PDBe:1jkq, PDBj:1jkq
PDBsum1jkq
PubMed11847127
UniProtP03013|HIN_SALTY DNA-invertase hin (Gene Name=hin)

[Back to BioLiP]