Structure of PDB 1jeb Chain C

Receptor sequence

>1jebC (length=141) Species: 9606 (Homo sapiens)

SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHP
GSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKL
LSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR

3D structure

• PDB: 1jeb The role of beta chains in the control of the hemoglobin oxygen binding function: chimeric human/mouse proteins, structure, and function.
• Chain: C
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Y42 F43 H45 F46 H58 K61 L83 H87 L91 V93 N97	Y42 F43 H45 F46 H58 K61 L83 H87 L91 V93 N97

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015670 carbon dioxide transport
• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1jeb, PDBe:1jeb, PDBj:1jeb
• PDBsum: 1jeb
• PubMed: 11747442
• UniProt: P02008|HBAZ_HUMAN Hemoglobin subunit zeta (Gene Name=HBZ)