Structure of PDB 1ijw Chain C

Receptor sequence
>1ijwC (length=47) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence]
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSI
3D structure
PDB1ijw Testing water-mediated DNA recognition by the Hin recombinase.
ChainC
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C G139 R140 R142 A143 I171 G172 S174 T175 R178 Y179 G1 R2 R4 A5 I33 G34 S36 T37 R40 Y41 PDBbind-CN: Kd=3.8nM
BS02 dna C G139 R140 P141 Y177 P181 A182 S183 G1 R2 P3 Y39 P43 A44 S45 PDBbind-CN: Kd=3.8nM
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ijw, PDBe:1ijw, PDBj:1ijw
PDBsum1ijw
PubMed11847127
UniProtP03013|HIN_SALTY DNA-invertase hin (Gene Name=hin)

[Back to BioLiP]