Structure of PDB 1icc Chain C |
>1iccC (length=83) Species: 10116 (Rattus norvegicus) [Search protein sequence] |
VTYYRLEEVAKRNTSEETWMVIHGRVYDLTRFLSEHPGGEEVLREQAGAD ATESFEDVGHSPDAREMLKQYYIGDVHPNDLKP |
|
PDB | 1icc Probing the differences between rat liver outer mitochondrial membrane cytochrome b5 and microsomal cytochromes b5. |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H39 G62 |
Catalytic site (residue number reindexed from 1) |
H36 G59 |
Enzyme Commision number |
? |
|
|
|
|