Structure of PDB 1i5l Chain C

Receptor sequence

>1i5lC (length=74) Species: 2234 (Archaeoglobus fulgidus)

MPPRPLDVLNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEIQN
GEVVRKVGSVVIRGDTVVFVSPAP

3D structure

• PDB: 1i5l RNA binding in an Sm core domain: X-ray structure and functional analysis of an archaeal Sm protein complex.
• Chain: C
• Resolution: 2.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	URI	C	H37 N39 R63 D65	H37 N39 R63 D65

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Cellular Component

• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1i5l, PDBe:1i5l, PDBj:1i5l
• PDBsum: 1i5l
• PubMed: 11331594
• UniProt: O29386|RUXX_ARCFU Putative snRNP Sm-like protein (Gene Name=AF_0875)