Structure of PDB 1i0x Chain C

Receptor sequence
>1i0xC (length=104) Species: 5062 (Aspergillus oryzae) [Search protein sequence]
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDF
SVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNF
VECT
3D structure
PDB1i0x The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
ChainC
Resolution1.65 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y38 H40 E58 D76 R77 T91 H92 F100
Catalytic site (residue number reindexed from 1) Y38 H40 E58 D76 R77 T91 H92 F100
Enzyme Commision number 4.6.1.24: ribonuclease T1.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 2GP C H40 Y42 N43 N44 Y45 E46 H40 Y42 N43 N44 Y45 E46
BS02 2GP C Y38 H40 E58 P73 G74 R77 H92 N98 F100 Y38 H40 E58 P73 G74 R77 H92 N98 F100
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
GO:0016829 lyase activity
GO:0046589 ribonuclease T1 activity
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0001411 hyphal tip
GO:0030428 cell septum

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i0x, PDBe:1i0x, PDBj:1i0x
PDBsum1i0x
PubMed11453993
UniProtP00651|RNT1_ASPOR Guanyl-specific ribonuclease T1 (Gene Name=rntA)

[Back to BioLiP]