Structure of PDB 1hsh Chain C

Receptor sequence

>1hshC (length=99) Species: 11720 (Human immunodeficiency virus type 2 (ISOLATE ROD))

PQFSLWKRPVVTAYIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGI
GGFINTKEYKNVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL

3D structure

• PDB: 1hsh Crystal structure at 1.9-A resolution of human immunodeficiency virus (HIV) II protease complexed with L-735,524, an orally bioavailable inhibitor of the HIV proteases.
• Chain: C
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27
• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.47: HIV-2 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MK1	C	D25 G27 A28 D29 D30 I32 G48 I50 P81 I82	D25 G27 A28 D29 D30 I32 G48 I50 P81 I82	MOAD: Ki=2.45nM

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:1hsh, PDBe:1hsh, PDBj:1hsh
• PDBsum: 1hsh
• PubMed: 7929352
• UniProt: P04584|POL_HV2RO Gag-Pol polyprotein (Gene Name=gag-pol)