Structure of PDB 1hr0 Chain C

Receptor sequence

>1hr0C (length=206) Species: 274 (Thermus thermophilus)

GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAG
LARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVAL
NVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKV
IVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAY
IFLGEV

3D structure

• PDB: 1hr0 Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
• Chain: C
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	G2 N3 K4 I5 K27 R127 S154 R156 G159 E161 Q162 A163 W167 R172 V173 P174 H176 T177 L178 R179 F186 T192 Y193 G194 V195 G197 K199	G1 N2 K3 I4 K26 R126 S153 R155 G158 E160 Q161 A162 W166 R171 V172 P173 H175 T176 L177 R178 F185 T191 Y192 G193 V194 G196 K198

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1hr0, PDBe:1hr0, PDBj:1hr0
• PDBsum: 1hr0
• PubMed: 11228145
• UniProt: P80372|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)