Structure of PDB 1hbh Chain C

Receptor sequence
>1hbhC (length=142) Species: 40690 (Trematomus bernacchii) [Search protein sequence]
SLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVT
PGSPHIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPANFK
ILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR
3D structure
PDB1hbh Structure of deoxyhaemoglobin of the antarctic fish Pagothenia bernacchii with an analysis of the structural basis of the root effect by comparison of the liganded and unliganded haemoglobin structures.
ChainC
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM C Y42 H45 H59 K62 V63 L84 H88 L92 V94 N98 F99 L137 Y42 H45 H59 K62 V63 L84 H88 L92 V94 N98 F99 L137
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hbh, PDBe:1hbh, PDBj:1hbh
PDBsum1hbh
PubMed7623382
UniProtP80043|HBA_TREBE Hemoglobin subunit alpha (Gene Name=hba)

[Back to BioLiP]